close

SimulationCraft 703-04

for World of Warcraft 7.0.3 Live (wow build level 22522, git build 25de3cd)

Current simulator hotfixes

Lorachristra

Lorachristra : 252047 dps

  • Race: Human
  • Class: Warlock
  • Spec: Destruction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
252046.6 252046.6 129.8 / 0.051% 25962.0 / 10.3% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
34340.2 34340.2 Mana 0.00% 47.1 100.0% 100%
Origin Lorachristra.json
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Reverse Entropy (Destruction Warlock)
  • 45: Demon Skin
  • 60: Eradication (Destruction Warlock)
  • 75: Dark Pact
  • 90: Grimoire of Service
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • herbalism: 353
  • tailoring: 760
Scale Factors for Lorachristra Damage Per Second
Int SP Haste Crit Vers Mastery
Scale Factors 7.39 7.01 6.83 6.71 6.46 5.84
Normalized 1.00 0.95 0.92 0.91 0.87 0.79
Scale Deltas 1138 1138 1138 1138 1138 1138
Error 0.16 0.16 0.16 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Lorachristra": Intellect=7.39, SpellPower=7.01, CritRating=6.71, HasteRating=6.83, MasteryRating=5.84, Versatility=6.46 )

Scale Factors for other metrics

Scale Factors for Lorachristra Damage Per Second
Int SP Haste Crit Vers Mastery
Scale Factors 7.39 7.01 6.83 6.71 6.46 5.84
Normalized 1.00 0.95 0.92 0.91 0.87 0.79
Scale Deltas 1138 1138 1138 1138 1138 1138
Error 0.16 0.16 0.16 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Lorachristra": Intellect=7.39, SpellPower=7.01, CritRating=6.71, HasteRating=6.83, MasteryRating=5.84, Versatility=6.46 )
Scale Factors for Lorachristra Priority Target Damage Per Second
Int SP Haste Crit Vers Mastery
Scale Factors 7.39 7.01 6.83 6.71 6.46 5.84
Normalized 1.00 0.95 0.92 0.91 0.87 0.79
Scale Deltas 1138 1138 1138 1138 1138 1138
Error 0.16 0.16 0.16 0.16 0.16 0.16
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Lorachristra": Intellect=7.39, SpellPower=7.01, CritRating=6.71, HasteRating=6.83, MasteryRating=5.84, Versatility=6.46 )
Scale Factors for Lorachristra Damage Per Second (Effective)
Int SP Haste Crit Vers Mastery
Scale Factors 7.39 7.01 6.83 6.71 6.46 5.84
Normalized 1.00 0.95 0.92 0.91 0.87 0.79
Scale Deltas 1138 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > SP > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Lorachristra": Intellect=7.39, SpellPower=7.01, CritRating=6.71, HasteRating=6.83, MasteryRating=5.84, Versatility=6.46 )
Scale Factors for Lorachristra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for Lorachristra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )
Scale Factors for LorachristraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Lorachristra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Lorachristra 252047
Chaos Bolt 61162 24.3% 62.3 7.14sec 441033 300679 Direct 63.1 0 435547 435547 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.34 63.12 0.00 0.00 1.4668 0.0000 27492550.64 27492550.64 0.00 300678.63 300678.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 63.12 100.00% 435547.17 302379 572543 435371.34 399802 472641 27492551 27492551 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 23378 9.3% 51.4 8.82sec 204864 182729 Direct 51.4 118830 269638 204864 57.0%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.36 51.36 0.00 0.00 1.1211 0.0000 10520807.76 10520807.76 0.00 182729.05 182729.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.06 42.95% 118829.72 80986 153345 118816.40 100731 133477 2621124 2621124 0.00
crit 29.30 57.05% 269638.49 161985 354112 269696.35 236793 299595 7899683 7899683 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6569 2.6% 30.8 15.17sec 94593 0 Direct 30.6 82340 164680 94959 15.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.76 30.64 0.00 0.00 0.0000 0.0000 2909393.25 2909393.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.94 84.68% 82339.92 82340 82340 82339.92 82340 82340 2136177 2136177 0.00
crit 4.70 15.32% 164679.84 164680 164680 163526.97 0 164680 773216 773216 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:5.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 34091 13.5% 25.6 17.90sec 600632 533350 Direct 25.6 82084 164136 114547 39.6%  
Periodic 201.3 44258 88514 61714 39.4% 99.3%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.55 25.55 201.27 201.27 1.1262 2.2231 15348219.76 15348219.76 0.00 32229.26 533350.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.44 60.44% 82084.27 56187 106388 82085.11 68153 95938 1267688 1267688 0.00
crit 10.11 39.56% 164136.45 112374 212774 164104.60 129985 203046 1659400 1659400 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.9 60.56% 44257.71 863 57626 44262.61 41613 46875 5394237 5394237 0.00
crit 79.4 39.44% 88514.10 1946 115251 88523.23 83158 95010 7026895 7026895 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.24
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFF{$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 60977 24.3% 191.8 2.31sec 143340 110721 Direct 190.9 124723 249497 143993 15.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 191.76 190.89 0.00 0.00 1.2946 0.0000 27486713.38 27486713.38 0.00 110721.46 110721.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.41 84.56% 124722.99 85826 162509 124760.48 119180 131933 20131631 20131631 0.00
crit 29.48 15.44% 249496.71 171652 325017 249607.83 222705 278846 7355082 7355082 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.remains
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 2984 1.2% 17.0 26.03sec 79096 0 Direct 83.8 13880 27760 16028 15.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.98 83.81 0.00 0.00 0.0000 0.0000 1343253.13 1343253.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.83 84.52% 13879.84 13880 13880 13879.84 13880 13880 983152 983152 0.00
crit 12.97 15.48% 27759.68 27760 27760 27756.90 0 27760 360101 360101 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - imp 19561 / 19561
Firebolt 19561 7.8% 154.0 2.93sec 57202 43696 Direct 153.2 49774 99557 57474 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.96 153.23 0.00 0.00 1.3091 0.0000 8806769.55 8806769.55 0.00 43695.64 43695.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.53 84.53% 49774.36 33260 49889 49772.66 49532 49889 6447329 6447329 0.00
crit 23.70 15.47% 99556.72 66519 99779 99553.94 95621 99779 2359441 2359441 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 53731 / 16911
Firebolt 53731 6.7% 66.4 6.44sec 114573 89882 Direct 66.0 99776 199553 115143 15.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.36 66.03 0.00 0.00 1.2747 0.0000 7603243.01 7603243.01 0.00 89882.41 89882.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.86 84.60% 99776.08 66519 99779 99776.08 98926 99779 5573770 5573770 0.00
crit 10.17 15.40% 199552.59 133038 199557 199552.77 191242 199557 2029473 2029473 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?c3[ Damage increased by {$s2=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.820000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 27972 / 1579
Immolation 15017 0.3% 1.0 0.00sec 375442 0 Periodic 21.0 15467 30935 17878 15.6% 5.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.00 21.00 0.0000 1.1820 375442.17 375442.17 0.00 15125.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.7 84.41% 15467.40 15467 15467 15467.40 15467 15467 274189 274189 0.00
crit 3.3 15.59% 30934.80 30935 30935 30012.85 0 30935 101254 101254 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 12955 0.3% 21.0 1.18sec 15424 13049 Direct 21.0 13360 26721 15424 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.1820 0.0000 323893.97 476154.81 31.98 13048.67 13048.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.76 84.56% 13360.46 13360 13360 13360.46 13360 13360 237245 348773 31.98
crit 3.24 15.44% 26720.92 26721 26721 25940.59 0 26721 86649 127382 31.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 31463 / 3247
Doom Bolt 31463 1.3% 18.5 10.72sec 79103 34304 Direct 18.4 68866 137719 79606 15.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.48 18.37 0.00 0.00 2.3060 0.0000 1462101.80 1462101.80 0.00 34303.92 34303.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.50 84.40% 68866.13 65308 78369 68674.54 65308 75355 1067595 1067595 0.00
crit 2.86 15.60% 137719.22 130616 156739 129818.21 0 156739 394506 394506 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 27946 / 1577
Immolation 14996 0.3% 1.0 0.00sec 374907 0 Periodic 21.0 15467 30935 17853 15.4% 5.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.00 21.00 0.0000 1.1820 374906.94 374906.94 0.00 15103.82 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.8 84.58% 15467.40 15467 15467 15467.40 15467 15467 274724 274724 0.00
crit 3.2 15.42% 30934.80 30935 30935 30000.48 0 30935 100183 100183 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 12951 0.3% 21.0 1.18sec 15418 13044 Direct 21.0 13360 26721 15418 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.1820 0.0000 323779.05 475985.88 31.98 13044.04 13044.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.77 84.60% 13360.46 13360 13360 13360.46 13360 13360 237360 348942 31.98
crit 3.23 15.40% 26720.92 26721 26721 25948.61 0 26721 86419 127044 31.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 27964 / 1578
Immolation 14998 0.3% 1.0 0.00sec 374975 0 Periodic 21.0 15467 30935 17856 15.4% 5.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.00 21.00 0.0000 1.1820 374975.01 374975.01 0.00 15106.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.8 84.56% 15467.40 15467 15467 15467.40 15467 15467 274656 274656 0.00
crit 3.2 15.44% 30934.80 30935 30935 29975.73 0 30935 100319 100319 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 12966 0.3% 21.0 1.18sec 15436 13059 Direct 21.0 13360 26721 15436 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.1820 0.0000 324157.19 476541.78 31.98 13059.27 13059.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.74 84.46% 13360.46 13360 13360 13360.46 13360 13360 236982 348386 31.98
crit 3.26 15.54% 26720.92 26721 26721 25991.37 0 26721 87175 128156 31.10
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 27948 / 1577
Immolation 14991 0.3% 1.0 0.00sec 374783 0 Periodic 21.0 15467 30935 17847 15.4% 5.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.00 21.00 0.0000 1.1820 374783.19 374783.19 0.00 15098.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.8 84.62% 15467.40 15467 15467 15467.40 15467 15467 274848 274848 0.00
crit 3.2 15.38% 30934.80 30935 30935 29873.63 0 30935 99936 99936 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 12957 0.3% 21.0 1.18sec 15426 13050 Direct 21.0 13360 26721 15426 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 0.00 0.00 1.1820 0.0000 323936.72 476217.67 31.98 13050.39 13050.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.75 84.54% 13360.46 13360 13360 13360.46 13360 13360 237203 348710 31.98
crit 3.25 15.46% 26720.92 26721 26721 25903.18 0 26721 86734 127507 31.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 59929 / 7117
Shadow Bolt 59929 2.8% 4.2 99.12sec 757916 0 Periodic 43.1 64029 127910 73926 15.5% 12.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.21 0.00 43.30 43.14 0.0000 1.3359 3188984.74 3188984.74 0.00 55123.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.5 84.51% 64028.99 7469 68745 63962.36 0 68745 2334244 2334244 0.00
crit 6.7 15.49% 127910.17 14939 137490 126103.40 0 137490 854741 854741 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 81478 / 3677
Chaos Bolt 81478 1.5% 4.2 96.14sec 395618 178189 Direct 4.2 0 396871 396871 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.17 0.00 0.00 2.2203 0.0000 1655017.93 1655017.93 0.00 178188.84 178188.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.17 100.00% 396871.24 396871 396871 396791.18 0 396871 1655018 1655018 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 137340 / 6188
Chaos Barrage 137340 2.4% 4.2 96.92sec 663380 0 Periodic 128.9 18643 37287 21536 15.5% 5.1%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 0.00 129.29 128.87 0.0000 0.1765 2775253.79 2775253.79 0.00 121598.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.9 84.48% 18643.29 2058 18906 18641.07 0 18906 2029744 2029744 0.00
crit 20.0 15.52% 37287.24 4116 37811 37277.23 0 37811 745509 745509 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Lorachristra
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lorachristra
  • harmful:false
  • if_expr:
 
Dimensional Rift 12.5 40.12sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.49 0.00 0.00 0.00 1.1148 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lorachristra
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lorachristra
  • harmful:false
  • if_expr:
 
Life Tap 0.0 0.00sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.1575 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mana_tap.enabled&mana.pct<=10
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 5.4 91.22sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 0.00 0.00 1.1082 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Summon Doomguard 1.9 183.12sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.94 0.00 0.00 0.00 1.1575 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.8905 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 51.4 0.0 8.8sec 8.8sec 42.21% 42.79% 0.0(0.0) 50.9

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_backdraft
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:42.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.03% 16.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 25.7 0.0 17.4sec 17.4sec 51.04% 49.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:51.04%

Trigger Attempt Success

  • trigger_pct:50.13%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your Conflagrate will always critically strike. Critical strike chance will increase the critical strike damage of Conflagrate.
  • description:{$@spelldesc219195=Conflagrate has a chance to guarantee your next Conflagrate critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.14% 99.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 407.7sec 0.0sec 13.09% 13.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:13.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Lorachristra
chaos_bolt Soul Shard 63.3 126.7 2.0 2.0 217022.7
conflagrate Mana 51.4 1129804.5 22000.0 21999.9 9.3
immolate Mana 25.6 1686538.4 66000.0 66000.4 9.1
incinerate Mana 191.8 12655755.6 66000.0 65998.4 2.2
service_imp Soul Shard 5.4 5.4 1.0 1.0 0.0
summon_doomguard Soul Shard 1.9 1.9 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 154.0 6158.4 40.0 40.0 1430.0
pet - service_imp
firebolt Energy 66.4 2654.4 40.0 40.0 2864.4
pet - doomguard
doom_bolt Energy 18.5 647.0 35.0 35.0 2259.9
Resource Gains Type Count Total Average Overflow
immolate Soul Shard 42.17 42.16 (31.65%) 1.00 0.01 0.02%
conflagrate Soul Shard 51.35 51.35 (38.55%) 1.00 0.00 0.00%
life_tap Mana 0.00 1154.19 (0.01%) 330000.00 0.00 0.00%
mp5_regen Mana 742.83 5551516.38 (36.28%) 7473.48 1069922.19 16.16%
soul_conduit Soul Shard 27.05 27.05 (20.31%) 1.00 0.00 0.00%
reverse_entropy Mana 63.34 9747972.34 (63.71%) 153898.52 14638028.46 60.03%
soulsnatcher Soul Shard 12.64 12.64 (9.49%) 1.00 0.00 0.01%
pet - imp
energy_regen Energy 2794.23 5993.31 (100.00%) 2.14 22.75 0.38%
pet - service_imp
energy_regen Energy 594.88 1798.53 (100.00%) 3.02 94.43 4.99%
pet - infernal
energy_regen Energy 271.00 0.00 (0.00%) 0.00 422.79 100.00%
pet - doomguard
energy_regen Energy 18.48 579.60 (100.00%) 31.36 85.81 12.90%
pet - lord_of_flames_infernal
energy_regen Energy 271.00 0.00 (0.00%) 0.00 422.79 100.00%
pet - lord_of_flames_infernal
energy_regen Energy 271.00 0.00 (0.00%) 0.00 422.79 100.00%
pet - lord_of_flames_infernal
energy_regen Energy 271.00 0.00 (0.00%) 0.00 422.79 100.00%
Resource RPS-Gain RPS-Loss
Health 0.00 1.52
Mana 33959.68 34340.22
Soul Shard 0.30 0.30
Combat End Resource Mean Min Max
Mana 932696.51 177439.02 1100000.00
Soul Shard 1.19 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.7%

Procs

Count Interval
shadowy_tear 4.2 94.6sec
chaos_tear 4.2 94.9sec
chaos_portal 4.1 95.2sec
soul_conduit 27.0 17.9sec

Statistics & Data Analysis

Fight Length
Sample Data Lorachristra Fight Length
Count 9999
Mean 450.56
Minimum 323.22
Maximum 577.89
Spread ( max - min ) 254.67
Range [ ( max - min ) / 2 * 100% ] 28.26%
DPS
Sample Data Lorachristra Damage Per Second
Count 9999
Mean 252046.61
Minimum 231012.66
Maximum 283354.77
Spread ( max - min ) 52342.11
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 6620.7385
5th Percentile 241574.18
95th Percentile 263335.90
( 95th Percentile - 5th Percentile ) 21761.73
Mean Distribution
Standard Deviation 66.2107
95.00% Confidence Intervall ( 251916.84 - 252176.38 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2650
0.1 Scale Factor Error with Delta=300 374193
0.05 Scale Factor Error with Delta=300 1496775
0.01 Scale Factor Error with Delta=300 37419375
Priority Target DPS
Sample Data Lorachristra Priority Target Damage Per Second
Count 9999
Mean 252046.61
Minimum 231012.66
Maximum 283354.77
Spread ( max - min ) 52342.11
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 6620.7385
5th Percentile 241574.18
95th Percentile 263335.90
( 95th Percentile - 5th Percentile ) 21761.73
Mean Distribution
Standard Deviation 66.2107
95.00% Confidence Intervall ( 251916.84 - 252176.38 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2650
0.1 Scale Factor Error with Delta=300 374193
0.05 Scale Factor Error with Delta=300 1496775
0.01 Scale Factor Error with Delta=300 37419375
DPS(e)
Sample Data Lorachristra Damage Per Second (Effective)
Count 9999
Mean 252046.61
Minimum 231012.66
Maximum 283354.77
Spread ( max - min ) 52342.11
Range [ ( max - min ) / 2 * 100% ] 10.38%
Damage
Sample Data Lorachristra Damage
Count 9999
Mean 85100937.91
Minimum 66267744.24
Maximum 105616715.81
Spread ( max - min ) 39348971.57
Range [ ( max - min ) / 2 * 100% ] 23.12%
DTPS
Sample Data Lorachristra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Lorachristra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Lorachristra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Lorachristra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Lorachristra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Lorachristra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data LorachristraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Lorachristra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 potion,name=deadly_grace
A 0.00 mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
0.00 havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
C 1.00 dimensional_rift,if=charges=3
D 9.72 immolate,if=remains<=tick_time
0.00 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
0.00 berserking
0.00 blood_fury
0.00 arcane_torrent
E 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
F 26.15 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
G 0.17 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
H 5.42 service_pet
I 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
J 1.94 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
K 45.29 chaos_bolt,if=soul_shard>3|buff.backdraft.remains
0.00 chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
L 90.33 incinerate,if=buff.backdraft.remains
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
M 11.49 dimensional_rift
0.00 mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
N 17.21 chaos_bolt
0.00 cataclysm
O 25.04 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
P 15.93 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
0.00 life_tap,if=talent.mana_tap.enabled&mana.pct<=10
Q 101.88 incinerate
R 0.00 life_tap

Sample Sequence

01269BCDFHILFLLLFKLLMMQPFKLLQQQOLKLQQQFLLLNPQOLLLQQQFKLLMPQQOLLLNNOKLLPQQQFKLLQQFKLLPQMQHOLLLQQFKKPQQQFKLLQQQOKLLPQQNNNMGLKLOKKDQOKLLQQQFKLLPQNFKLLQQQOKLLDMNHJNOLLLQOKLDQQOKLLQQQOKLLDQQQFKLLMQQFLLDQQQFKLLQQQOKDLQQQOLKLQQPFKKMQHQOLLLQQQFKDKNQFLKLQQQFLDKQQQFKLLMNPFKKQQQQOLLLQQPOKKQQQQFKLLQPQFKLLHMQOJLLQQPQOLLLQQQFKKNNNDFLLLQQFKKMQPQOEKLLQQQNOLLLPQOKLLQQQOKKQPNFLLHMQQQ

Sample Sequence Table

time name target resources buffs
Pre flask Lorachristra 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Lorachristra 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Lorachristra 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:00.000 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard potion_of_deadly_grace
0:01.119 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:02.008 conflagrate Fluffy_Pillow 1034055.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, potion_of_deadly_grace
0:02.899 service_imp Fluffy_Pillow 1028630.9/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:03.789 summon_infernal Fluffy_Pillow 1045187.3/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, potion_of_deadly_grace
0:04.679 incinerate Fluffy_Pillow 1061743.8/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:05.509 conflagrate Fluffy_Pillow 1011184.1/1100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:06.399 incinerate Fluffy_Pillow 1005740.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:07.230 incinerate Fluffy_Pillow 955199.4/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:08.061 incinerate Fluffy_Pillow 904658.3/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:08.893 conflagrate Fluffy_Pillow 854135.8/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:09.993 chaos_bolt Fluffy_Pillow 852598.8/1100000: 78% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:11.033 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:11.867 incinerate Fluffy_Pillow 1034130.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:12.697 dimensional_rift Fluffy_Pillow 983570.5/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:13.588 dimensional_rift Fluffy_Pillow 1000145.6/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:14.478 incinerate Fluffy_Pillow 1016702.0/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:15.663 immolate Fluffy_Pillow 972746.3/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:16.552 conflagrate Fluffy_Pillow 923284.1/1100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:17.442 chaos_bolt Fluffy_Pillow 917840.6/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:18.478 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:19.309 incinerate Fluffy_Pillow 1034074.4/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:20.142 incinerate Fluffy_Pillow 983570.5/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:21.331 incinerate Fluffy_Pillow 939689.2/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:22.518 incinerate Fluffy_Pillow 895770.7/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:23.702 conflagrate Fluffy_Pillow 851796.3/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:24.593 incinerate Fluffy_Pillow 846371.4/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:25.424 chaos_bolt Fluffy_Pillow 795830.3/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:26.461 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_deadly_grace
0:27.292 incinerate Fluffy_Pillow 1034074.4/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, potion_of_deadly_grace
0:28.479 incinerate Fluffy_Pillow 990155.9/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames
0:29.665 incinerate Fluffy_Pillow 946218.8/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames
0:30.852 conflagrate Fluffy_Pillow 902300.2/1100000: 82% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames
0:31.743 incinerate Fluffy_Pillow 896875.3/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos
0:32.577 incinerate Fluffy_Pillow 846390.0/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos
0:33.410 incinerate Fluffy_Pillow 795886.1/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos
0:34.242 chaos_bolt Fluffy_Pillow 745363.6/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:35.722 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:36.612 incinerate Fluffy_Pillow 1034074.4/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:37.798 conflagrate Fluffy_Pillow 990137.3/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos
0:38.689 incinerate Fluffy_Pillow 984712.3/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames
0:39.520 incinerate Fluffy_Pillow 934171.2/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames
0:40.349 incinerate Fluffy_Pillow 883592.9/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames
0:41.181 incinerate Fluffy_Pillow 829498.7/1100000: 75% mana | 1.0/5: 20% soul_shard lord_of_flames
0:42.723 incinerate Fluffy_Pillow 785564.4/1100000: 71% mana | 1.0/5: 20% soul_shard lord_of_flames
0:44.265 incinerate Fluffy_Pillow 741630.2/1100000: 67% mana | 1.0/5: 20% soul_shard lord_of_flames
0:45.808 conflagrate Fluffy_Pillow 697710.2/1100000: 63% mana | 1.0/5: 20% soul_shard lord_of_flames
0:46.967 chaos_bolt Fluffy_Pillow 692295.3/1100000: 63% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:48.318 incinerate Fluffy_Pillow 1096627.8/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:49.399 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:50.478 dimensional_rift Fluffy_Pillow 983526.1/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:51.635 immolate Fluffy_Pillow 1000082.6/1100000: 91% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:52.791 incinerate Fluffy_Pillow 950624.8/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:54.332 incinerate Fluffy_Pillow 906676.2/1100000: 82% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:55.874 conflagrate Fluffy_Pillow 862741.9/1100000: 78% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
0:57.032 incinerate Fluffy_Pillow 857312.7/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:58.112 incinerate Fluffy_Pillow 806767.3/1100000: 73% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:59.193 incinerate Fluffy_Pillow 756236.2/1100000: 69% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:00.271 chaos_bolt Fluffy_Pillow 705662.2/1100000: 64% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:02.196 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:04.121 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:05.280 chaos_bolt Fluffy_Pillow 1094585.1/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
1:06.627 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:07.708 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:08.788 immolate Fluffy_Pillow 983540.5/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
1:09.946 incinerate Fluffy_Pillow 934111.2/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
1:11.489 incinerate Fluffy_Pillow 890191.3/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
1:13.032 incinerate Fluffy_Pillow 846271.3/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames
1:14.572 conflagrate Fluffy_Pillow 802308.4/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames
1:15.729 chaos_bolt Fluffy_Pillow 796864.9/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
1:17.078 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:18.159 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:19.238 incinerate Fluffy_Pillow 983526.1/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
1:20.778 incinerate Fluffy_Pillow 939563.3/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
1:22.321 conflagrate Fluffy_Pillow 895643.3/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
1:23.706 chaos_bolt Fluffy_Pillow 893462.4/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:25.054 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:26.133 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:27.211 immolate Fluffy_Pillow 983483.2/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
1:28.367 incinerate Fluffy_Pillow 934025.4/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
1:29.908 dimensional_rift Fluffy_Pillow 890076.8/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:31.157 incinerate Fluffy_Pillow 907949.8/1100000: 83% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:32.699 service_imp Fluffy_Pillow 864015.5/1100000: 79% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:34.055 conflagrate Fluffy_Pillow 883419.6/1100000: 80% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
1:35.213 incinerate Fluffy_Pillow 877990.4/1100000: 80% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:36.293 incinerate Fluffy_Pillow 827445.0/1100000: 75% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:37.372 incinerate Fluffy_Pillow 776885.3/1100000: 71% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
1:38.451 incinerate Fluffy_Pillow 726325.5/1100000: 66% mana | 1.0/5: 20% soul_shard lord_of_flames
1:39.993 incinerate Fluffy_Pillow 682391.3/1100000: 62% mana | 1.0/5: 20% soul_shard lord_of_flames
1:41.532 conflagrate Fluffy_Pillow 638414.1/1100000: 58% mana | 2.0/5: 40% soul_shard lord_of_flames
1:42.691 chaos_bolt Fluffy_Pillow 632999.2/1100000: 58% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames
1:44.040 chaos_bolt Fluffy_Pillow 1037303.1/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
1:45.388 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
1:46.546 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
1:48.088 incinerate Fluffy_Pillow 990137.3/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
1:49.630 incinerate Fluffy_Pillow 946203.0/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
1:51.174 conflagrate Fluffy_Pillow 902297.4/1100000: 82% mana | 2.0/5: 40% soul_shard lord_of_flames
1:52.330 chaos_bolt Fluffy_Pillow 896839.5/1100000: 82% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:53.679 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:54.759 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:55.839 incinerate Fluffy_Pillow 983526.1/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:57.381 incinerate Fluffy_Pillow 939591.9/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
1:58.922 incinerate Fluffy_Pillow 895643.3/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:00.463 conflagrate Fluffy_Pillow 851694.7/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:01.620 chaos_bolt Fluffy_Pillow 846251.2/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:02.970 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:04.048 incinerate Fluffy_Pillow 1034042.9/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:05.128 immolate Fluffy_Pillow 983497.5/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:06.284 incinerate Fluffy_Pillow 934039.7/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:07.826 incinerate Fluffy_Pillow 890105.4/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:09.367 chaos_bolt Fluffy_Pillow 846156.8/1100000: 77% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:11.293 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:13.217 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:15.143 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:16.300 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:17.457 incinerate Fluffy_Pillow 1094556.5/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:18.537 chaos_bolt Fluffy_Pillow 1034071.5/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:19.884 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:20.962 conflagrate Fluffy_Pillow 1034042.9/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:22.119 chaos_bolt Fluffy_Pillow 1028599.4/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:23.469 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:24.816 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:25.974 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:27.517 conflagrate Fluffy_Pillow 990151.6/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:28.675 chaos_bolt Fluffy_Pillow 984722.4/1100000: 90% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames
2:30.024 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:31.104 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:32.183 incinerate Fluffy_Pillow 983511.8/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
2:33.724 incinerate Fluffy_Pillow 939563.3/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
2:35.268 incinerate Fluffy_Pillow 895657.6/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
2:36.808 conflagrate Fluffy_Pillow 851694.7/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames
2:37.964 chaos_bolt Fluffy_Pillow 846236.9/1100000: 77% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames
2:39.312 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:40.393 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
2:41.474 immolate Fluffy_Pillow 983554.8/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
2:42.632 incinerate Fluffy_Pillow 934125.5/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
2:44.173 chaos_bolt Fluffy_Pillow 890177.0/1100000: 81% mana | 2.0/5: 40% soul_shard lord_of_flames
2:46.098 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
2:47.255 chaos_bolt Fluffy_Pillow 1094556.5/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:48.604 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:49.682 incinerate Fluffy_Pillow 1034042.9/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:50.762 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:52.304 incinerate Fluffy_Pillow 939563.3/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
2:53.845 incinerate Fluffy_Pillow 895614.7/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:55.386 conflagrate Fluffy_Pillow 851666.1/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:56.546 chaos_bolt Fluffy_Pillow 846265.5/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:57.895 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:58.975 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:00.054 immolate Fluffy_Pillow 983511.8/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:01.213 dimensional_rift Fluffy_Pillow 934096.9/1100000: 85% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:02.370 chaos_bolt Fluffy_Pillow 950653.4/1100000: 86% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:04.294 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:05.451 summon_doomguard Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
3:06.608 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
3:08.532 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
3:09.689 incinerate Fluffy_Pillow 1094556.5/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:10.768 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:11.847 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:12.926 incinerate Fluffy_Pillow 932937.8/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:14.468 conflagrate Fluffy_Pillow 889003.6/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:15.627 chaos_bolt Fluffy_Pillow 883588.6/1100000: 80% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:16.976 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:18.055 immolate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:19.211 incinerate Fluffy_Pillow 984599.4/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:20.754 incinerate Fluffy_Pillow 940679.4/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:22.296 conflagrate Fluffy_Pillow 896745.2/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:23.619 chaos_bolt Fluffy_Pillow 893677.1/1100000: 81% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:24.967 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:26.046 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:27.125 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:28.667 incinerate Fluffy_Pillow 939563.3/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:30.209 incinerate Fluffy_Pillow 895629.0/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:31.750 conflagrate Fluffy_Pillow 851680.4/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:32.907 chaos_bolt Fluffy_Pillow 846236.9/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
3:34.255 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
3:35.334 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
3:36.413 immolate Fluffy_Pillow 983497.5/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames
3:37.570 incinerate Fluffy_Pillow 934054.0/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames
3:39.111 incinerate Fluffy_Pillow 890105.4/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
3:40.653 incinerate Fluffy_Pillow 846171.1/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames
3:42.196 conflagrate Fluffy_Pillow 802251.2/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames
3:43.352 chaos_bolt Fluffy_Pillow 796793.3/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
3:44.699 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
3:45.779 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
3:46.859 dimensional_rift Fluffy_Pillow 983526.1/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames
3:48.017 incinerate Fluffy_Pillow 1000096.9/1100000: 91% mana | 0.0/5: 0% soul_shard lord_of_flames
3:49.559 incinerate Fluffy_Pillow 956162.7/1100000: 87% mana | 0.0/5: 0% soul_shard lord_of_flames
3:51.100 conflagrate Fluffy_Pillow 912214.1/1100000: 83% mana | 0.0/5: 0% soul_shard lord_of_flames
3:52.258 incinerate Fluffy_Pillow 906784.8/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
3:53.340 incinerate Fluffy_Pillow 856268.1/1100000: 78% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
3:54.418 immolate Fluffy_Pillow 805694.0/1100000: 73% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
3:55.576 incinerate Fluffy_Pillow 756264.8/1100000: 69% mana | 1.0/5: 20% soul_shard lord_of_flames
3:57.119 incinerate Fluffy_Pillow 712344.9/1100000: 65% mana | 1.0/5: 20% soul_shard lord_of_flames
3:58.661 incinerate Fluffy_Pillow 668410.6/1100000: 61% mana | 1.0/5: 20% soul_shard lord_of_flames
4:00.202 conflagrate Fluffy_Pillow 624462.0/1100000: 57% mana | 1.0/5: 20% soul_shard lord_of_flames
4:01.360 chaos_bolt Fluffy_Pillow 619032.8/1100000: 56% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:02.708 incinerate Fluffy_Pillow 1023322.4/1100000: 93% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:03.787 incinerate Fluffy_Pillow 972762.7/1100000: 88% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:04.866 incinerate Fluffy_Pillow 922203.0/1100000: 84% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:06.407 incinerate Fluffy_Pillow 878254.4/1100000: 80% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:07.948 incinerate Fluffy_Pillow 834305.8/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:09.490 conflagrate Fluffy_Pillow 790371.6/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:10.648 chaos_bolt Fluffy_Pillow 784942.3/1100000: 71% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:11.996 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:13.154 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:14.232 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:15.773 incinerate Fluffy_Pillow 939549.0/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:17.315 incinerate Fluffy_Pillow 895614.7/1100000: 81% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:18.856 conflagrate Fluffy_Pillow 851666.1/1100000: 77% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:20.013 incinerate Fluffy_Pillow 846222.6/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:21.092 chaos_bolt Fluffy_Pillow 795662.9/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
4:22.441 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:23.521 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
4:25.064 incinerate Fluffy_Pillow 990151.6/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
4:26.606 immolate Fluffy_Pillow 946217.3/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
4:27.763 conflagrate Fluffy_Pillow 896773.8/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames
4:28.920 chaos_bolt Fluffy_Pillow 891330.2/1100000: 81% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:30.268 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:31.617 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:32.773 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:34.315 service_imp Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
4:35.472 incinerate Fluffy_Pillow 1050628.0/1100000: 96% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:37.013 conflagrate Fluffy_Pillow 1006679.4/1100000: 92% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:38.168 incinerate Fluffy_Pillow 1001207.3/1100000: 91% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:39.249 incinerate Fluffy_Pillow 950676.2/1100000: 86% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:40.328 incinerate Fluffy_Pillow 900116.5/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:41.408 incinerate Fluffy_Pillow 849571.1/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames
4:42.950 incinerate Fluffy_Pillow 805636.8/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames
4:44.490 incinerate Fluffy_Pillow 761673.9/1100000: 69% mana | 1.0/5: 20% soul_shard lord_of_flames
4:46.031 conflagrate Fluffy_Pillow 717725.3/1100000: 65% mana | 1.0/5: 20% soul_shard lord_of_flames
4:47.189 chaos_bolt Fluffy_Pillow 712296.1/1100000: 65% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
4:48.537 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
4:49.692 chaos_bolt Fluffy_Pillow 1034028.6/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
4:51.042 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames
4:52.968 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
4:54.509 conflagrate Fluffy_Pillow 1034057.2/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
4:55.857 incinerate Fluffy_Pillow 1031346.9/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
4:56.935 chaos_bolt Fluffy_Pillow 980772.9/1100000: 89% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
4:58.282 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames
4:59.362 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
5:00.903 incinerate Fluffy_Pillow 990123.0/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames
5:02.445 incinerate Fluffy_Pillow 946188.7/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames
5:03.987 conflagrate Fluffy_Pillow 902254.4/1100000: 82% mana | 0.0/5: 0% soul_shard lord_of_flames
5:05.145 incinerate Fluffy_Pillow 896825.2/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
5:06.224 immolate Fluffy_Pillow 846265.5/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
5:07.382 chaos_bolt Fluffy_Pillow 796836.3/1100000: 72% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
5:08.731 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames
5:10.271 incinerate Fluffy_Pillow 1034042.9/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
5:11.812 incinerate Fluffy_Pillow 990094.4/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
5:13.355 conflagrate Fluffy_Pillow 946174.4/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
5:14.512 chaos_bolt Fluffy_Pillow 940730.9/1100000: 86% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
5:15.860 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
5:16.939 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
5:18.017 dimensional_rift Fluffy_Pillow 983483.2/1100000: 89% mana | 2.0/5: 40% soul_shard lord_of_flames
5:19.173 chaos_bolt Fluffy_Pillow 1000025.4/1100000: 91% mana | 2.0/5: 40% soul_shard lord_of_flames
5:21.100 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames
5:22.259 conflagrate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
5:23.530 chaos_bolt Fluffy_Pillow 1030273.6/1100000: 94% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
5:24.878 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
5:26.225 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
5:27.767 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
5:29.308 incinerate Fluffy_Pillow 990123.0/1100000: 90% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
5:30.848 incinerate Fluffy_Pillow 946160.1/1100000: 86% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
5:32.389 conflagrate Fluffy_Pillow 902211.5/1100000: 82% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
5:33.548 incinerate Fluffy_Pillow 896796.6/1100000: 82% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
5:34.628 incinerate Fluffy_Pillow 846251.2/1100000: 77% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
5:35.709 incinerate Fluffy_Pillow 795720.1/1100000: 72% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
5:36.788 incinerate Fluffy_Pillow 745160.4/1100000: 68% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
5:38.330 incinerate Fluffy_Pillow 701226.1/1100000: 64% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
5:39.871 immolate Fluffy_Pillow 657277.6/1100000: 60% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
5:41.029 conflagrate Fluffy_Pillow 607848.3/1100000: 55% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
5:42.186 chaos_bolt Fluffy_Pillow 602404.8/1100000: 55% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames
5:43.533 chaos_bolt Fluffy_Pillow 1006680.1/1100000: 92% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames
5:44.880 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames
5:46.423 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
5:47.964 incinerate Fluffy_Pillow 990137.3/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames
5:49.506 incinerate Fluffy_Pillow 946203.0/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames
5:51.047 conflagrate Fluffy_Pillow 902254.4/1100000: 82% mana | 2.0/5: 40% soul_shard lord_of_flames
5:52.203 chaos_bolt Fluffy_Pillow 896796.6/1100000: 82% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames
5:53.551 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
5:54.631 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
5:55.709 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames
5:57.252 immolate Fluffy_Pillow 939577.6/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames
5:58.409 incinerate Fluffy_Pillow 890134.0/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames
5:59.950 conflagrate Fluffy_Pillow 846185.5/1100000: 77% mana | 2.0/5: 40% soul_shard lord_of_flames
6:01.107 chaos_bolt Fluffy_Pillow 840741.9/1100000: 76% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:02.456 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:03.536 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:04.616 service_imp Fluffy_Pillow 983526.1/1100000: 89% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:05.774 dimensional_rift Fluffy_Pillow 1000096.9/1100000: 91% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:06.932 incinerate Fluffy_Pillow 1016667.7/1100000: 92% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:08.474 conflagrate Fluffy_Pillow 972733.4/1100000: 88% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:09.649 summon_doomguard Fluffy_Pillow 967547.5/1100000: 88% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:10.805 incinerate Fluffy_Pillow 984089.6/1100000: 89% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:11.886 incinerate Fluffy_Pillow 933558.5/1100000: 85% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:12.966 incinerate Fluffy_Pillow 883013.1/1100000: 80% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:14.507 incinerate Fluffy_Pillow 839064.5/1100000: 76% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:16.048 immolate Fluffy_Pillow 795116.0/1100000: 72% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:17.205 incinerate Fluffy_Pillow 745672.4/1100000: 68% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:18.746 conflagrate Fluffy_Pillow 701723.8/1100000: 64% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
6:19.904 incinerate Fluffy_Pillow 696294.6/1100000: 63% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:20.984 incinerate Fluffy_Pillow 645749.2/1100000: 59% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:22.063 incinerate Fluffy_Pillow 595189.5/1100000: 54% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:23.142 incinerate Fluffy_Pillow 544629.8/1100000: 50% mana | 1.0/5: 20% soul_shard lord_of_flames
6:24.684 incinerate Fluffy_Pillow 500695.5/1100000: 46% mana | 1.0/5: 20% soul_shard lord_of_flames
6:26.224 incinerate Fluffy_Pillow 456732.6/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames
6:27.767 conflagrate Fluffy_Pillow 412812.7/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames
6:28.925 chaos_bolt Fluffy_Pillow 407383.5/1100000: 37% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames
6:30.273 chaos_bolt Fluffy_Pillow 811673.1/1100000: 74% mana | 5.0/5: 100% soul_shard backdraft, lord_of_flames
6:31.621 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard lord_of_flames
6:33.548 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard lord_of_flames
6:35.473 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard lord_of_flames
6:37.399 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
6:38.556 conflagrate Fluffy_Pillow 1034057.2/1100000: 94% mana | 0.0/5: 0% soul_shard lord_of_flames
6:39.714 incinerate Fluffy_Pillow 1028628.0/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:40.793 incinerate Fluffy_Pillow 978068.3/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:41.875 incinerate Fluffy_Pillow 927551.5/1100000: 84% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
6:42.955 incinerate Fluffy_Pillow 877006.1/1100000: 80% mana | 1.0/5: 20% soul_shard lord_of_flames
6:44.496 incinerate Fluffy_Pillow 833057.5/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames
6:46.037 conflagrate Fluffy_Pillow 789109.0/1100000: 72% mana | 1.0/5: 20% soul_shard lord_of_flames
6:47.197 chaos_bolt Fluffy_Pillow 783708.4/1100000: 71% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:48.546 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:49.894 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:51.053 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:52.594 immolate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:53.754 incinerate Fluffy_Pillow 984656.6/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:55.294 conflagrate Fluffy_Pillow 940693.7/1100000: 86% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
6:56.451 potion Fluffy_Pillow 935250.2/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
6:56.451 chaos_bolt Fluffy_Pillow 935250.2/1100000: 85% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
6:57.801 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
6:58.879 incinerate Fluffy_Pillow 1034042.9/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
6:59.959 incinerate Fluffy_Pillow 983497.5/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:01.498 incinerate Fluffy_Pillow 939520.3/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:03.040 incinerate Fluffy_Pillow 895586.1/1100000: 81% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:04.580 chaos_bolt Fluffy_Pillow 851623.2/1100000: 77% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:06.504 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:07.663 incinerate Fluffy_Pillow 1094585.1/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:08.742 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:09.822 incinerate Fluffy_Pillow 983511.8/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:10.902 immolate Fluffy_Pillow 932966.4/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:12.059 incinerate Fluffy_Pillow 883522.9/1100000: 80% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:13.601 conflagrate Fluffy_Pillow 839588.6/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:14.758 chaos_bolt Fluffy_Pillow 834145.1/1100000: 76% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:16.106 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:17.185 incinerate Fluffy_Pillow 1034057.2/1100000: 94% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:18.265 incinerate Fluffy_Pillow 983511.8/1100000: 89% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:19.806 incinerate Fluffy_Pillow 939563.3/1100000: 85% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:21.346 incinerate Fluffy_Pillow 895600.4/1100000: 81% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:22.889 conflagrate Fluffy_Pillow 851680.4/1100000: 77% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
7:24.046 chaos_bolt Fluffy_Pillow 846236.9/1100000: 77% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, potion_of_deadly_grace
7:25.395 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, potion_of_deadly_grace
7:26.741 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard lord_of_flames
7:28.282 immolate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard lord_of_flames
7:29.439 chaos_bolt Fluffy_Pillow 984613.7/1100000: 90% mana | 2.0/5: 40% soul_shard lord_of_flames
7:31.365 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard lord_of_flames
7:32.667 incinerate Fluffy_Pillow 1094585.1/1100000: 100% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
7:33.748 incinerate Fluffy_Pillow 1034085.9/1100000: 94% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
7:34.828 service_imp Fluffy_Pillow 983540.5/1100000: 89% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames
7:35.984 dimensional_rift Fluffy_Pillow 1000082.6/1100000: 91% mana | 1.0/5: 20% soul_shard lord_of_flames
7:37.142 incinerate Fluffy_Pillow 1016653.4/1100000: 92% mana | 1.0/5: 20% soul_shard lord_of_flames
7:38.682 incinerate Fluffy_Pillow 972690.5/1100000: 88% mana | 1.0/5: 20% soul_shard lord_of_flames
7:40.222 incinerate Fluffy_Pillow 928727.6/1100000: 84% mana | 1.0/5: 20% soul_shard lord_of_flames

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4200 3875 0
Agility 7252 6927 0
Stamina 32553 32553 20479
Intellect 34372 32666 23783 (2257)
Spirit 0 0 0
Health 1953180 1953180 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 34372 32666 0
Crit 15.46% 15.46% 3662
Haste 30.09% 28.91% 9396
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 14310 14180 0
Mastery 69.06% 69.06% 5257
Armor 1644 1644 1644
Run Speed 7 0 443
Leech 3.82% 3.82% 878

Gear

Source Slot Average Item Level: 857.00
Local Head Cragshaper's Fitted Hood
ilevel: 840, stats: { 204 Armor, +1182 Int, +1773 Sta, +736 Haste, +521 Crit }
Local Neck Chain of a Hundred Maws
ilevel: 850, stats: { +1094 Sta, +1311 Haste, +525 Mastery }
Local Shoulders Night Dreamer Mantle
ilevel: 850, stats: { 195 Armor, +973 Int, +1459 Sta, +574 Haste, +406 Mastery }
Local Chest Night Dreamer Robe
ilevel: 845, stats: { 256 Armor, +1238 Int, +1857 Sta, +915 Haste, +366 Mastery, +549 Avoidance }
Local Waist Poisonroot Belt
ilevel: 840, stats: { 141 Armor, +886 Int, +1329 Sta, +552 Mastery, +391 Crit }
Local Legs Ragged Horrorweave Leggings
ilevel: 855, stats: { 232 Armor, +2038 Sta, +1359 Int, +751 Haste, +579 Mastery }
Local Feet Mistbound Helarjar Footwraps
ilevel: 860, stats: { 185 Armor, +1601 Sta, +1068 Int, +595 Haste, +421 Crit, +435 Leech }, gems: { +100 Haste }
Local Wrists Ragged Fur Wristwraps
ilevel: 870, stats: { 122 Armor, +1319 Sta, +879 Int, +446 Mastery, +345 Haste }
Local Hands Bonespeaker Gloves
ilevel: 865, stats: { 172 Armor, +1119 Int, +1678 Sta, +695 Crit, +340 Mastery, +443 Leech }
Local Finger1 Mindrend Band
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Haste }, enchant: { +150 Haste }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 860, stats: { +1201 Sta, +1307 Crit, +599 Haste }, enchant: { +150 Haste }
Local Trinket1 Bloom of New Growth
ilevel: 845, stats: { +1177 Int, +915 Haste }, gems: { +100 Haste }
Local Trinket2 Twisting Wind
ilevel: 865, stats: { +1418 AgiInt, +443 RunSpeed }
Local Back Evergreen Vinewrap Drape
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +521 Haste, +255 Crit }, enchant: { +150 Int }
Local Main Hand Scepter of Sargeras
ilevel: 884, weapon: { 4606 - 6911, 3.6 }, stats: { +1781 Int, +2671 Sta, +742 Haste, +742 Mastery, +9714 Int }, relics: { +49 ilevels, +43 ilevels, +42 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Cataclysm (Destruction Warlock) Mana Tap
45 Demon Skin Mortal Coil Shadowfury
60 Eradication (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demonic Circle Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Lorachristra"
origin="Lorachristra.json"
thumbnail="http://us.battle.net/static-render/us/whisperwind/204/131763148-avatar.jpg"
level=110
race=human
role=spell
position=back
professions=tailoring=760/herbalism=353
talents=http://us.battle.net/wow/en/tool/talent-calculator#Vb!0000212
artifact=38:0:0:0:0:803:1:807:3:808:3:809:3:810:3:811:3:812:3:814:1:815:1:817:1:818:1:1355:1
spec=destruction

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/mana_tap,if=talent.mana_tap.enabled&!buff.mana_tap.remains
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/havoc,target=2,if=active_enemies>1&!talent.wreak_havoc.enabled&talent.roaring_blaze.enabled&!debuff.roaring_blaze.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&!debuff.roaring_blaze.remains&action.conflagrate.charges<2
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2|(action.conflagrate.charges>=1&action.conflagrate.recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&prev_gcd.conflagrate
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=2
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack=3&buff.bloodlust.remains
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/chaos_bolt,if=soul_shard>3|buff.backdraft.remains
actions+=/chaos_bolt,if=buff.backdraft.remains&prev_gcd.incinerate
actions+=/incinerate,if=buff.backdraft.remains
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/mana_tap,if=buff.mana_tap.remains<=buff.mana_tap.duration*0.3&(mana.pct<20|buff.mana_tap.remains<=action.chaos_bolt.cast_time)&target.time_to_die>buff.mana_tap.duration*0.3
actions+=/chaos_bolt
actions+=/cataclysm
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/life_tap,if=talent.mana_tap.enabled&mana.pct<=10
actions+=/incinerate
actions+=/life_tap

head=cragshapers_fitted_hood,id=137341,bonus_id=1727/1492/1813
neck=chain_of_a_hundred_maws,id=134498,bonus_id=3410/1502/3336
shoulders=night_dreamer_mantle,id=139091,bonus_id=3395/1512/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1487/3337,enchant=150int
chest=night_dreamer_robe,id=139089,bonus_id=1726/40/1507/3337
wrists=ragged_fur_wristwraps,id=139196,bonus_id=1805/1492/3336
hands=bonespeaker_gloves,id=134217,bonus_id=1727/41/1527/3337
waist=poisonroot_belt,id=134423,bonus_id=1727/1492/1813
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1807/1477/3336
feet=mistbound_helarjar_footwraps,id=133608,bonus_id=3411/1808/41/1512/3337,gems=100haste
finger1=mindrend_band,id=138220,bonus_id=1807/1482/3336,enchant=150haste
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1482/3336,enchant=150haste
trinket1=bloom_of_new_growth,id=139076,bonus_id=3432/1808/604/1507/3336,gems=100haste
trinket2=twisting_wind,id=139323,bonus_id=1805/42/1487
main_hand=scepter_of_sargeras,id=128941,bonus_id=749,gem_id=139253/139256/141255/0,relic_id=1805:1492:3336/1807:1472/3432:1507:3336/0

# Gear Summary
# gear_ilvl=856.93
# gear_stamina=20479
# gear_intellect=23783
# gear_crit_rating=3590
# gear_haste_rating=9212
# gear_mastery_rating=5154
# gear_leech_rating=878
# gear_speed_rating=443
# gear_avoidance_rating=549
# gear_armor=1644
default_pet=imp

Simulation & Raid Information

Iterations: 10007
Threads: 8
Confidence: 95.00%
Fight Length: 323 - 578 ( 450.6 )

Performance:
Total Events Processed: 86178962
Max Event Queue: 98
Sim Seconds: 4508772
CPU Seconds: 67.3012
Physical Seconds: 8.6075
Speed Up: 66994

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Lorachristra Lorachristra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra chaos_bolt 116858 27492551 61018 8.41 0 435547 62.3 63.1 100.0% 0.0% 0.0% 0.0% 7.14sec 27492551 450.56sec
Lorachristra Lorachristra conflagrate 17962 10520808 23350 6.84 118830 269638 51.4 51.4 57.0% 0.0% 0.0% 0.0% 8.82sec 10520808 450.56sec
Lorachristra Lorachristra deadly_grace 188091 2909393 6457 4.08 82340 164680 30.8 30.6 15.3% 0.0% 0.0% 0.0% 15.17sec 2909393 450.56sec
Lorachristra Lorachristra dimensional_rift 196586 0 0 0.00 0 0 12.5 0.0 0.0% 0.0% 0.0% 0.0% 40.12sec 0 450.56sec
Lorachristra Lorachristra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra immolate 348 2927088 6497 3.40 82084 164136 25.6 25.6 39.6% 0.0% 0.0% 0.0% 17.90sec 15348220 450.56sec
Lorachristra Lorachristra immolate ticks -348 12421132 27603 26.84 44258 88514 25.6 201.3 39.4% 0.0% 0.0% 0.0% 17.90sec 15348220 450.56sec
Lorachristra Lorachristra incinerate 29722 27486713 61005 25.42 124723 249497 191.8 190.9 15.4% 0.0% 0.0% 0.0% 2.31sec 27486713 450.56sec
Lorachristra Lorachristra life_tap 1454 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra service_imp 111859 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 91.22sec 0 450.56sec
Lorachristra Lorachristra summon_doomguard 18540 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 183.12sec 0 450.56sec
Lorachristra Lorachristra summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.56sec
Lorachristra Lorachristra tormenting_cyclone 221857 1343253 2981 11.16 13880 27760 17.0 83.8 15.5% 0.0% 0.0% 0.0% 26.03sec 1343253 450.56sec
Lorachristra Lorachristra_imp firebolt 3110 8806770 19546 20.41 49774 99557 154.0 153.2 15.5% 0.0% 0.0% 0.0% 2.93sec 8806770 450.56sec
Lorachristra Lorachristra_service_imp firebolt 3110 7603243 53680 27.97 99776 199553 66.4 66.0 15.4% 0.0% 0.0% 0.0% 6.44sec 7603243 141.64sec
Lorachristra Lorachristra_infernal immolation ticks -19483 375442 834 2.80 15467 30935 1.0 21.0 15.6% 0.0% 0.0% 0.0% 0.00sec 375442 25.00sec
Lorachristra Lorachristra_infernal melee 0 323894 12955 50.40 13360 26721 21.0 21.0 15.4% 0.0% 0.0% 0.0% 1.18sec 476155 25.00sec
Lorachristra Lorachristra_doomguard doom_bolt 85692 1462102 31600 23.82 68866 137719 18.5 18.4 15.6% 0.0% 0.0% 0.0% 10.72sec 1462102 46.27sec
Lorachristra Lorachristra_lord_of_flames_infernal immolation ticks -19483 374907 833 2.80 15467 30935 1.0 21.0 15.4% 0.0% 0.0% 0.0% 0.00sec 374907 25.00sec
Lorachristra Lorachristra_lord_of_flames_infernal melee 0 323779 12951 50.40 13360 26721 21.0 21.0 15.4% 0.0% 0.0% 0.0% 1.18sec 475986 25.00sec
Lorachristra Lorachristra_lord_of_flames_infernal immolation ticks -19483 374975 833 2.80 15467 30935 1.0 21.0 15.4% 0.0% 0.0% 0.0% 0.00sec 374975 25.00sec
Lorachristra Lorachristra_lord_of_flames_infernal melee 0 324157 12966 50.40 13360 26721 21.0 21.0 15.5% 0.0% 0.0% 0.0% 1.18sec 476542 25.00sec
Lorachristra Lorachristra_lord_of_flames_infernal immolation ticks -19483 374783 833 2.80 15467 30935 1.0 21.0 15.4% 0.0% 0.0% 0.0% 0.00sec 374783 25.00sec
Lorachristra Lorachristra_lord_of_flames_infernal melee 0 323937 12957 50.40 13360 26721 21.0 21.0 15.5% 0.0% 0.0% 0.0% 1.18sec 476218 25.00sec
Lorachristra Lorachristra_shadowy_tear shadow_bolt ticks -196657 3188985 7087 5.77 64029 127910 4.2 43.3 15.5% 0.0% 0.0% 0.0% 99.12sec 3188985 53.98sec
Lorachristra Lorachristra_chaos_tear chaos_bolt 215279 1655018 81347 12.30 0 396871 4.2 4.2 100.0% 0.0% 0.0% 0.0% 96.14sec 1655018 20.35sec
Lorachristra Lorachristra_chaos_portal chaos_barrage ticks -187394 2775254 6167 17.24 18643 37287 4.2 129.3 15.5% 0.0% 0.0% 0.0% 96.92sec 2775254 20.29sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.70% 9.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.02% 11.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.95% 10.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.23% 11.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.86% 10.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.97% 10.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.09% 11.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.23% 11.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.99% 7.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.96% 4.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 30.3 32.8 15.0sec 7.1sec 68.72% 68.72% 32.8(32.8) 29.6

Buff details

  • buff initial source:Lorachristra
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:68.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 251299.92
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 10001
death count pct 99.94
avg death time 450.56
min death time 323.22
max death time 577.89
dmg taken 113330901.65

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 450.56
Minimum 323.22
Maximum 577.89
Spread ( max - min ) 254.67
Range [ ( max - min ) / 2 * 100% ] 28.26%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 252046.61
Minimum 231012.66
Maximum 283354.77
Spread ( max - min ) 52342.11
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 6620.7385
5th Percentile 241574.18
95th Percentile 263335.90
( 95th Percentile - 5th Percentile ) 21761.73
Mean Distribution
Standard Deviation 66.2107
95.00% Confidence Intervall ( 251916.84 - 252176.38 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2650
0.1 Scale Factor Error with Delta=300 374193
0.05 Scale Factor Error with Delta=300 1496775
0.01 Scale Factor Error with Delta=300 37419375
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1228
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 90604242 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.